PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT22670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 246aa    MW: 25599.2 Da    PI: 7.4941
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT22670genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.61.6e-30158215158
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
               ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp +v++tYeg+H h
  EMT22670 158 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDRDDPAYVVTTYEGTHSH 215
               59*******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-32144218IPR003657WRKY domain
SuperFamilySSF1182901.57E-27150218IPR003657WRKY domain
PROSITE profilePS5081130.997153218IPR003657WRKY domain
SMARTSM007743.3E-34158217IPR003657WRKY domain
PfamPF031062.5E-24159215IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MAAVGAAPLL YQQQAQAAGD GCYFSFMSSY FSHGEASSNA SSPASSFSAA LGATPPAAPR  60
STSSSPASSF SAALGATPPA APAIAADITA QFDISEYLFE EGAFAATLPP VVSVPAVGAA  120
AASSATAVTA RSAESAAAAE RPRTERIAFR TRTEIEILDD GYKWRKYGKK SVKNSPNPRN  180
YYRCSTEGCS VKKRVERDRD DPAYVVTTYE GTHSHVSPST VYYASQDAAS GRFFVAGTHP  240
PPGSLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-25148218777Probable WRKY transcription factor 4
1wj2_A2e-25148218777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8274020.0KR827402.1 Triticum aestivum WRKY51 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568011.14e-80PREDICTED: probable WRKY transcription factor 48
SwissprotQ93WU98e-45WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLM8BCQ21e-176M8BCQ2_AEGTA; Uncharacterized protein
STRINGMLOC_10264.21e-101(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.12e-40WRKY DNA-binding protein 51